USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
4th of July Sequin Pocket

4th of July Sequin Pocket

RRP $16.49
$13.19 inc. tax
$11.99 ex. tax
? Tax based on Alabama, United States.
The shirts are very comfortable to wear and you won’t feel tight in the armpits. Rayon and Spandex fabric making it comfier against the skin. Sequence pocket accentuate the whole look.
Product Code: eo70Lrt
Product Condition: New
Promotion Offer!
Free Shipping when you spend $75
Spend $75.00 on eligible products and get Free Shipping!
Choose from the following eligible products:

Collections : All Products,

Product Added to your Cart
x

-------- OR --------

Register to earn Bloom Bucks points
Kudzu Klub
Join our VIP rewards program today!
Register to earn Bloom Bucks
Points mean prizes!
Ways to earn
Welcome gift
Place an order
Write a review
see more..
Ways to redeem
Money off!
% discount!
Free Shipping
see more..
Join today
Already have an account?Sign in